Protein coding transcript 61312

• Transcript: Ll_transcript_419387
• CDS coordinates: 343-735 (+)
• Peptide sequence: MTEVLHSPASHFSSSSSDGILSPPPPPPPSVVVEGFSTVTDCDRVEVTDNNEKGSGEEEEVSLLAILVTLFRKSLIACNSIDRSELCAMEIGWPTNVRHVAHVTFDRFNGFLGLPVEFEPEVPRRAPSAR*
• ORF Type: complete

Annotations of Ll_transcript_419387

• Blastp: Rho GTPase-activating protein 1 from Arabidopsis with 49.04% of identity
• Blastx: Rho GTPase-activating protein 1 from Arabidopsis with 79.22% of identity
• Eggnog: rho GTPase activating protein(ENOG410XRR2)
• Kegg: Link to kegg annotations (AT5G22400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448844.1)
• Pfam: P21-Rho-binding domain (PF00786.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;