Protein coding transcript 61314

• Transcript: Ll_transcript_419410
• CDS coordinates: 385-1578 (+)
• Peptide sequence: MREEEKEVSLLAILVTLFRKSLMACNSVDRRELCAMEIGFPTNVRHVAHVTFDRFNGFLGLPVEFEPEVPRRAPSASATVFGVSTESMQLSYETRGNSVPTILLLMQRRLYAQGGLQAEGIFRINADNSKDEYYREQLNRGLIPDDIDVHSLAGLIKAWFREMPVSVLDSLSPEQVMQSQIEEDCAELARQLPQTEASLLDWAINLMADVVQHEHLNKMNAHNIAMVFAPNMTQMEDPMSALMYAVQVMNFLKTLILRTLRERKDSAVETSPGFCLEPCDDNEDHSDLFYSCQQDATTENEEAVETFVYEKEVLECSLQSLQNINSTEAKCSSLVSSSYENLIWNEDFCFWVPPKGKVGKNKSGQPRRSSTKNVLQKNKVQQRIISGTMTVENGLAI*
• ORF Type: complete

Annotations of Ll_transcript_419410

• Blastp: Rho GTPase-activating protein 1 from Arabidopsis with 77.86% of identity
• Blastx: Rho GTPase-activating protein 1 from Arabidopsis with 77.86% of identity
• Eggnog: rho GTPase activating protein(ENOG410XRR2)
• Kegg: Link to kegg annotations (AT5G22400)
• CantataDB: Link to cantataDB annotations (CNT0000052)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451448.1)
• Pfam: P21-Rho-binding domain (PF00786.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;