Transcript | Ll_transcript_419400 |
---|---|
CDS coordinates | 931-1548 (+) |
Peptide sequence | MQAEGIFRINADNSKDEYYREQLNRGLIPDDIDVHSLAGLIKMEDPMSALMYAVQVMNFLKTLILRTLRERKDSAVETSPGFCLEPCDDNEDHSDLFYSCQQDATTENEEAVETFVYEKEVLECSLQSLQNINSTEAKCSSLVSSSYENLIWNEDFCFWVPPKGKVGKNKSGQPRRSSTKNVLQKNKVQQRIISGTMTVENGLAI* |
ORF Type | complete |
Blastp | Rho GTPase-activating protein 1 from Arabidopsis with 61.82% of identity |
---|---|
Blastx | Rho GTPase-activating protein 1 from Arabidopsis with 82.14% of identity |
Eggnog | rho GTPase activating protein(ENOG410XRR2) |
Kegg | Link to kegg annotations (AT5G22400) |
CantataDB | Link to cantataDB annotations (CNT0000052) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451448.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer