Protein coding transcript 61320

• Transcript: Ll_transcript_419401
• CDS coordinates: 742-1071 (+)
• Peptide sequence: MQCQTEENCAELARQLPHTEASLLDWAINLMADVVQHEHLNKMNARNIAMVFAPNMTRMADPMTALMYAVQVMNFLKTLILRTLRQRKDSVVEPSPGFCSEPFDDNEDHS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_419401

• Blastp: Rho GTPase-activating protein 1 from Arabidopsis with 74.55% of identity
• Blastx: Rho GTPase-activating protein 1 from Arabidopsis with 75.76% of identity
• Eggnog: rho GTPase activating protein(ENOG410XRR2)
• Kegg: Link to kegg annotations (AT5G22400)
• CantataDB: Link to cantataDB annotations (CNT0000052)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449622.1)
• Pfam: RhoGAP domain (PF00620.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;