Protein coding transcript 61325

• Transcript: Ll_transcript_420656
• CDS coordinates: 184-1185 (+)
• Peptide sequence: MASILSLTPHFSNPPHHPKNLSPFSLSLSPQGSLLHITRNHANASRLSICLKDEFCRPHYSYKLYVQNKFPRDIVVRSELAATGAAGDGYALSELKIGSQVRGACFYTVTAINALVLFVLMLVGHPLVLLFDRYRRKFHHFVAKVWAALTVAPFFNIKIEGLENLPPPDTPAVYVSNHQSFLDIYTLLTLGRTFKFISKTGIFLYPVIGWAMFLLGAIPLKRMDKRSQLDCLKRCMDLIKKGASVFFFPEGTRSKDGKLGTFKKGAFSVAAKMNAPVVPITLIGTGQIMPAGKEGIVNFGSVKVVIHKPIEGNDANMLCNEASKTIASALTQT*
• ORF Type: complete

Annotations of Ll_transcript_420656

• Blastp: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic from Brassica with 64.53% of identity
• Blastx: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic from Brassica with 64.53% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (106441094)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417020.1)
• Pfam: Acyltransferase (PF01553.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;