Transcript | Ll_transcript_421502 |
---|---|
CDS coordinates | 1794-2105 (+) |
Peptide sequence | MVYQYLTSGDPSSRGVTECLEEPPIPLCSVYASTRGEPPFTNYTPGFTGTLDYVLFCPSDHIKPISFLKLPDSNDADIAGGLPNYSHPSDHLPIGAEFEIIKE* |
ORF Type | complete |
Blastp | Carbon catabolite repressor protein 4 homolog 4 from Arabidopsis with 50% of identity |
---|---|
Blastx | Carbon catabolite repressor protein 4 homolog 4 from Arabidopsis with 65.97% of identity |
Eggnog | Ccr4-NOT transcription complex, subunit(COG5239) |
Kegg | Link to kegg annotations (AT1G31500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423637.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer