Protein coding transcript 61361

• Transcript: Ll_transcript_421477
• CDS coordinates: 2088-2399 (+)
• Peptide sequence: MVYQYLTSGDPSSRGVTECLEEPPIPLCSVYASTRGEPPFTNYTPGFTGTLDYVLFCPSDHIKPISFLKLPDSNDADIAGGLPNYSHPSDHLPIGAEFEIIKE*
• ORF Type: complete

Annotations of Ll_transcript_421477

• Blastp: Carbon catabolite repressor protein 4 homolog 4 from Arabidopsis with 61.17% of identity
• Blastx: Carbon catabolite repressor protein 4 homolog 4 from Arabidopsis with 65.97% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5239)
• Kegg: Link to kegg annotations (AT1G31500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423637.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;