Protein coding transcript 61362

• Transcript: Ll_transcript_421478
• CDS coordinates: 1094-1546 (+)
• Peptide sequence: MLPQNYGIDLVKTSWMIFWSIIMSMFNNLNLHLYFLLFSAELVLEDKIEYNDLVKSIQDENSPNDDENSNIQTVRPDKQKDVASKSGPKSNTEDRGDPNDPRVRLKRDCVGLLAAFKLKDPSRHVVIVANTHLYWYRSSFICCFISFFVC*
• ORF Type: complete

Annotations of Ll_transcript_421478

• Blastp: Carbon catabolite repressor protein 4 homolog 4 from Arabidopsis with 50% of identity
• Blastx: Carbon catabolite repressor protein 4 homolog 4 from Arabidopsis with 69.84% of identity
• Eggnog: Ccr4-NOT transcription complex, subunit(COG5239)
• Kegg: Link to kegg annotations (AT1G31500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003612546.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;