Protein coding transcript 61432

• Transcript: Ll_transcript_419492
• CDS coordinates: 193-1026 (+)
• Peptide sequence: MAVQNSLQITSSGSRSYEDDGRAKRTGTLTSAVAHIITAVIGAGVLSLAWSTSQLGWIAGPLSLMFCAIVTYVSSYLLSDCYRTPDPVSGKRNYSYTDAVRIYLGNKRTWLAAFLQYLTLYGTTTAYVITTATCLRAILKSNCFHKEGHQAPCKYGDTVYMMMFGLVQVIMSFIPDLHNMAWVSVVAATMSLTYSFIGLGLGLATVIENGRIMGSVTGVPAANIADKLWLVFQALGDIAFAYPYSVILLEIQVTFNFIFQYTRQNLKLMQSIETLFE*
• ORF Type: complete

Annotations of Ll_transcript_419492

• Blastp: Amino acid permease 1 from Arabidopsis with 52.4% of identity
• Blastx: Probable amino acid permease 7 from Arabidopsis with 58.82% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT1G58360)
• CantataDB: Link to cantataDB annotations (CNT0002804)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435717.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;