Protein coding transcript 61433

• Transcript: Ll_transcript_419493
• CDS coordinates: 193-555 (+)
• Peptide sequence: MAVQNSLQITSSGSRSYEDDGRAKRTGTLTSAVAHIITAVIGAGVLSLAWSTSQLGWIAGPLSLMFCAIVTYVSSYLLSDCYRTPDPVSGKRNYSYTDAVRIYLGTNVFHSLCSTTSVQL*
• ORF Type: complete

Annotations of Ll_transcript_419493

• Blastp: Amino acid permease 4 from Arabidopsis with 60.58% of identity
• Blastx: Amino acid permease 4 from Arabidopsis with 62.63% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G63850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435717.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;