Protein coding transcript 61498

• Transcript: Ll_transcript_420375
• CDS coordinates: 51-416 (+)
• Peptide sequence: MAMGRGSAMMLLFCLFVIHSEMVNAATYTVGDGGGWTFKTVGWPKGKNFRAGDTLVFNYNPSFHNVVVVNSAGYSSCKTPRGSKVYHSGKDQIKLSKGQNYFICNYVGHCEGGMKIAIYAA*
• ORF Type: complete

Annotations of Ll_transcript_420375

• Blastp: Basic blue protein from Arabidopsis with 59.38% of identity
• Blastx: Basic blue protein from Arabidopsis with 59.38% of identity
• Eggnog: Basic blue(ENOG410YPS7)
• Kegg: Link to kegg annotations (AT2G02850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431816.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;