Protein coding transcript 61529

• Transcript: Ll_transcript_420277
• CDS coordinates: 108-869 (+)
• Peptide sequence: MPLNMFKDKDGMPRIILTDPNGSSVEVLLYGAQVVSWKNQKKEELLFMSSKGNRKGGNKAKRGGISVWFPRFGDVSSVEEDGLGRKRLWSLDRDPSPLPLSDNHSSVDLILKSSGVYLKTPHLSFEFRLRICVSGGKLIMIPRVRNTDNKAFSFTFVMTNYLSVSDISEVRIEGLETLDYFDNLINRSRFTEQADAITFDAEMDRVYLHSPNKIAIIDHEKKRTFVLHKNAMPDAGTLIYHLINNNTYVYTIF*
• ORF Type: complete

Annotations of Ll_transcript_420277

• Blastp: Putative glucose-6-phosphate 1-epimerase from Cenchrus with 51.05% of identity
• Blastx: Putative glucose-6-phosphate 1-epimerase from Cenchrus with 49.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002022)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442516.1)
• Pfam: Aldose 1-epimerase (PF01263.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;