Transcript | Ll_transcript_420277 |
---|---|
CDS coordinates | 108-869 (+) |
Peptide sequence | MPLNMFKDKDGMPRIILTDPNGSSVEVLLYGAQVVSWKNQKKEELLFMSSKGNRKGGNKAKRGGISVWFPRFGDVSSVEEDGLGRKRLWSLDRDPSPLPLSDNHSSVDLILKSSGVYLKTPHLSFEFRLRICVSGGKLIMIPRVRNTDNKAFSFTFVMTNYLSVSDISEVRIEGLETLDYFDNLINRSRFTEQADAITFDAEMDRVYLHSPNKIAIIDHEKKRTFVLHKNAMPDAGTLIYHLINNNTYVYTIF* |
ORF Type | complete |
Blastp | Putative glucose-6-phosphate 1-epimerase from Cenchrus with 51.05% of identity |
---|---|
Blastx | Putative glucose-6-phosphate 1-epimerase from Cenchrus with 49.58% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002022) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442516.1) |
Pfam | Aldose 1-epimerase (PF01263.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer