Transcript | Ll_transcript_420142 |
---|---|
CDS coordinates | 431-1354 (+) |
Peptide sequence | MIAASYNGVLYNTGFQRCHSKISPSCSEIRSLTYVTGYSDSNKSSSQASLFLCPDSTNKTYGMLRGPFSWNKRNLVGQASYSVGTTTLDGIHLENPSHVAEEKVGVLLLNLGGPETLNDVQPFLFNLFADPDIIRLPRLFRFLQKPLAKLISVLRAPKSKEGYAAIGGGSPLRKTTDDQALALKVALEAKGLSSNVYVGMRYWYPFTEEAIQQIKRDGITRLVVLPLYPQFSISTTGSSIRVLQQVFRDDEYLSSLLVSVINSWYQREGYIKSMADLIEKELQSFSEPEEVGSVLFFTTFSMVLLMQ* |
ORF Type | complete |
Blastp | Ferrochelatase-2, chloroplastic from Cucumis with 74.15% of identity |
---|---|
Blastx | Ferrochelatase-2, chloroplastic from Cucumis with 68.57% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (101216568) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416925.1) |
Pfam | Ferrochelatase (PF00762.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer