Transcript | Ll_transcript_419696 |
---|---|
CDS coordinates | 679-1053 (+) |
Peptide sequence | MTWIVKYLHDEPKLLESVKAEQKAIQKSNEGNLPLSWNQTRNMPITYKVVLESLRMASIISFPFREAVADVEYKGFLIPKGWKAMPLFRNIHHNPEFFPEPKKFNPSRFEVSRTEVNSVLVKNM* |
ORF Type | complete |
Blastp | Abscisic acid 8'-hydroxylase 3 from Oryza sativa with 76.11% of identity |
---|---|
Blastx | Abscisic acid 8'-hydroxylase 4 from Arabidopsis with 67.54% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (4347261) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436954.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer