Protein coding transcript 61583

• Transcript: Ll_transcript_419696
• CDS coordinates: 679-1053 (+)
• Peptide sequence: MTWIVKYLHDEPKLLESVKAEQKAIQKSNEGNLPLSWNQTRNMPITYKVVLESLRMASIISFPFREAVADVEYKGFLIPKGWKAMPLFRNIHHNPEFFPEPKKFNPSRFEVSRTEVNSVLVKNM*
• ORF Type: complete

Annotations of Ll_transcript_419696

• Blastp: Abscisic acid 8'-hydroxylase 3 from Oryza sativa with 76.11% of identity
• Blastx: Abscisic acid 8'-hydroxylase 4 from Arabidopsis with 67.54% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (4347261)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436954.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;