Transcript | Ll_transcript_523905 |
---|---|
CDS coordinates | 113-517 (+) |
Peptide sequence | MAGEVPAGNHSPEEILSLIHDIAGMCSGDSSTADAIAGDAMFRKDCTDLVRRISLLTYLFEEINELTKVVDSAATSSTTTDTGDSDSWSSDLVLALHSAKRLLSIARNFRSNCSSVSISRSNIFLIFEFQLQLC* |
ORF Type | complete |
Blastp | U-box domain-containing protein 11 from Arabidopsis with 42.31% of identity |
---|---|
Blastx | U-box domain-containing protein 11 from Arabidopsis with 39.25% of identity |
Eggnog | Ubox domain-containing protein(ENOG410YBA5) |
Kegg | Link to kegg annotations (AT1G23030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445814.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer