Protein coding transcript 61623

• Transcript: Ll_transcript_420565
• CDS coordinates: 2-592 (+)
• Peptide sequence: FYLGHNTTQHNSLSLSLSLSLSFSHILKPTHFYPFSFSLLSLRIRVSFFNQFLPIHSPPTMYDHINQIVAIDDNNDTSATIESAEPVVNNHHSHIIHYEDGSGGVIEEVATENGGVYASGHVNMTTQALDDSSQLTLSFRGQVYVFDSVSPQKVRFFCCSFDFFSVLILTPFFLFQLGCEISKLCAKYSGAVFCYI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_420565

• Blastp: GATA transcription factor 24 from Arabidopsis with 39.44% of identity
• Blastx: GATA transcription factor 28 from Arabidopsis with 57.14% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT3G21175)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415824.1)
• Pfam: tify domain (PF06200.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;