Protein coding transcript 6163

• Transcript: Ll_transcript_523907
• CDS coordinates: 113-517 (+)
• Peptide sequence: MAGEVPAGNHSPEEILSLIHDIAGMCSGDSSTADAIAGDAMFRKDCTDLVRRISLLTYLFEEINELTKVVDSAATSSTTTDTGDSDSWSSDLVLALHSAKRLLSIARNFRSNCSSVSISRSNIFLIFEFQLQLC*
• ORF Type: complete

Annotations of Ll_transcript_523907

• Blastp: U-box domain-containing protein 11 from Arabidopsis with 42.31% of identity
• Blastx: U-box domain-containing protein 10 from Arabidopsis with 55.38% of identity
• Eggnog: Ubox domain-containing protein(ENOG410YBA5)
• Kegg: Link to kegg annotations (AT1G23030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445814.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;