Transcript | Ll_transcript_420857 |
---|---|
CDS coordinates | 297-1034 (+) |
Peptide sequence | MSVPLEQNYAALSPEILTMEKASEPFSHKTKTTTCSSGLNLKATELRLGLPGSESPERDENNVAVYPLSMHNKCFVSGAKRGFSDAIGGGSGKWILSGNGDSEVGLGKDGNLFSPKGVIVAKALVGAECTNQDKVPHSSMTLNEKKHQISATAAKEQVVGWPPIRSFRKNSMAIQPRKNNDDDDDDAETKSGCLYVKVSMDGAPYLRKVDLKNFATYRELSSALEKMFTCFTISEFFFYLQNCNK* |
ORF Type | complete |
Blastp | Auxin-responsive protein IAA27 from Arabidopsis with 51.64% of identity |
---|---|
Blastx | Auxin-responsive protein IAA27 from Arabidopsis with 51.64% of identity |
Eggnog | auxin-responsive protein(ENOG410YEX5) |
Kegg | Link to kegg annotations (AT4G29080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448380.1) |
Pfam | AUX/IAA family (PF02309.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer