Protein coding transcript 61764

• Transcript: Ll_transcript_420348
• CDS coordinates: 63-1157 (+)
• Peptide sequence: MSKALYFVLLLSACYLLFPPSSATDTIGVNYGTVADNLPPPSKVATFLKSQTIIDRVKIFDANPDILRAFSGTGIAVTVTVGNGDIPSLSKLPAAKTWVSTNILPFHPKTIINRIAVGNEILATSDKNLIAHTLPAMEALYQALTLANITTVQVSTPHSLGILSASEPPSSGQFRRGYDKAIFVPILDFLRKTKSPFLVNPYPFFGFAPNRPESLNYALFKPNGGVFDNVTGFNYTNMFDAQMDAVYSAMKKVGYEDVELVVAETGWPSAGDPNQAGVSVENAESHNGNLIKHVNSGKGTPLMPNRTFETYIFSLFNENLKPTHSEQNYGLLKPDVILVYDVGVLREQHVTLFHFRLFFSLFSN*
• ORF Type: complete

Annotations of Ll_transcript_420348

• Blastp: Glucan endo-1,3-beta-glucosidase from Triticum with 53.21% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase from Triticum with 53.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424335.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;