Transcript | Ll_transcript_420352 |
---|---|
CDS coordinates | 557-1066 (+) |
Peptide sequence | MSCIKKWLQQRKKHGKCPQCNRKCSLKDVRKLYASRLVAVDEESQKRIQSLEAKCAALESKGDDWRKKEAGWQKRKAALHLQVQKLAEKNIYLEQLLLDMQSRQSGIRNNGSSFYGKGSFCNFELQKTFQLSGARVFDMDTSKQIILVAQKPKVIGGMHSLTKVRFFNF* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase RFWD3 from Homo with 32.84% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase RFWD3 from Mus with 23.8% of identity |
Eggnog | ring finger and WD repeat domain 3(ENOG410XPPE) |
Kegg | Link to kegg annotations (55159) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424666.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer