Transcript | Ll_transcript_468494 |
---|---|
CDS coordinates | 23-583 (+) |
Peptide sequence | MGLPFIGDTLSFLKSPDFMKRRRSVYGNMFKTHALGSHMIVCMDPQINKYLLINEAKLGLTIAYPDSIKNIIGVNMAEVNGTVHKRVRGILLSLIGPAAHRDRLVLKMDKCMRSFLHNWAGKTIDIQQKARQMAFMGSLEQIVQDEPNSFYESFEDLFVKMFSGSMSPLINIPGTKYYQGLKARVKL |
ORF Type | 3prime_partial |
Blastp | Cytochrome P450 85A1 from Lycopersicon with 48.92% of identity |
---|---|
Blastx | Cytochrome P450 85A1 from Lycopersicon with 50.26% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (100037489) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459924.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer