Protein coding transcript 61823

• Transcript: Ll_transcript_419296
• CDS coordinates: 255-1238 (+)
• Peptide sequence: MALFIGAHMTAKMSQVFLHFIYLSLHVCAFLFWLPVFSFIMSNFIVKVLDWGEDGVATSAEAAALRASFKQEVAVWHKLHHPNVTKFVGASMGTSNLKIPLQNPTNGAQDSLPSRACCVVVEFVPGGTLKQYLIRNRRKKLAYKIVVQIALDLSRGLSYLHSKKIVHRDVKTENMLLDGNQNLKIADFGVARVEALNPSDMTGETGTLGYMAPEVLDGKPYNRRCDVYSFGICLWEIYCCDMPYPDLSFADVTSAVVRQNLRPEIPRCCPSGLANIMKKCWDGNPDKRPEMEEVVRMLEALDTSKGGGMIPEDQPKGCFCFAPTRGP*
• ORF Type: complete

Annotations of Ll_transcript_419296

• Blastp: Serine/threonine-protein kinase HT1 from Arabidopsis with 36.44% of identity
• Blastx: Serine/threonine-protein kinase HT1 from Arabidopsis with 36.51% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G62400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422818.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;