Protein coding transcript 61889

• Transcript: Ll_transcript_419652
• CDS coordinates: 237-1328 (+)
• Peptide sequence: MEKELLELYESAKKAADAAVSGDGESDESRCIDALQQLKKFPVNYKILVSTQVGKHLKSLTKHPRQKIRAFAIDLIEIWKNIIIKETSKNKNGGSDNKVEPANGESAKAGKFQRSLSVKVEKTETVKVEKIDRNGTPRSSSDSTKRTQNMDVKIEKTDRAANVKVEKQVSAVKRTSSSSAAPPKLKTMIKSNDSVRDKIRELLQEALSKVPGEADEDVLDEVNVCDPIRVAVTVESLLFEKWGPSNGAQKVKYRSLMFNLKDQNNPDFRRKVLLGVIKPERLIDMSTSEMASERRKQEIQKLEEKALFECERGAQPKATTDQFKCGRCGQRKTTYYQMQTRSADEPMTTYVTCVVCNNRWKFC*
• ORF Type: complete

Annotations of Ll_transcript_419652

• Blastp: Transcription elongation factor TFIIS from Arabidopsis with 53.85% of identity
• Blastx: Transcription elongation factor TFIIS from Arabidopsis with 53.61% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG1594)
• Kegg: Link to kegg annotations (AT2G38560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417297.1)
• Pfam: TFIIS helical bundle-like domain (PF08711.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;