Protein coding transcript 61891

• Transcript: Ll_transcript_419655
• CDS coordinates: 1478-2008 (+)
• Peptide sequence: MIKSNDSVRDKIRELLQEALSKVPGEADEDVLDEVNVCDPIRVAVTVESLLFEKWGPSNGAQKVKYRSLMFNLKDQNNPDFRRKVLLGVIKPERLIDMSTSEMASERRKQEIQKLEEKALFECERGAQPKATTDQFKCGRCGQRKTTYYQMQTRSADEPMTTYVTCVVCNNRWKFC*
• ORF Type: complete

Annotations of Ll_transcript_419655

• Blastp: Transcription elongation factor TFIIS from Arabidopsis with 70.45% of identity
• Blastx: Transcription elongation factor TFIIS from Arabidopsis with 52.54% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG1594)
• Kegg: Link to kegg annotations (AT2G38560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417297.1)
• Pfam: Transcription factor S-II (TFIIS), central domain (PF07500.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;