Protein coding transcript 61897

• Transcript: Ll_transcript_420960
• CDS coordinates: 705-1331 (+)
• Peptide sequence: MSHTIAGEQMPCRLINYEENYKFKNYVSSKGEKGLKGFVNELKEFETLDYVYVWHALCGYWGGIRPNVSGMPEAVIEKPKLSVGLETTMEDLAVDKIVNNGVGLVTPNMVHQMYEGLHSHLENAGIDGVKVDVIHLLEMVCEKYGGRVELAKAYYKALTNSVRKHFKGNGVIASMEHCNDFMLLGTEAISLGRVGMSFTLTIRTQHNT*
• ORF Type: complete

Annotations of Ll_transcript_420960

• Blastp: Galactinol--sucrose galactosyltransferase from Pisum with 74.13% of identity
• Blastx: Probable galactinol--sucrose galactosyltransferase 5 from Arabidopsis with 69.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442543.1)
• Pfam: Raffinose synthase or seed imbibition protein Sip1 (PF05691.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;