Protein coding transcript 619

• Transcript: Ll_transcript_468477
• CDS coordinates: 3-314 (+)
• Peptide sequence: ALCLARKFGTAKNMVATSLDSIESLRKKYTNVLSNLTQLKSLGCTILYKVDVHTMTEHQFLQSEHFHVIVFNFPHAGFIYREHDSRQIQLHRKLVRGFLNSAKH
• ORF Type: internal

Annotations of Ll_transcript_468477

• Blastp: Uncharacterized protein At4g26485 from Arabidopsis with 51.43% of identity
• Blastx: Uncharacterized protein At4g26485 from Arabidopsis with 51.43% of identity
• Eggnog: ferredoxin-fold anticodon binding domain containing 1(ENOG41108X7)
• Kegg: Link to kegg annotations (AT4G26485)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006604988.1)
• Pfam: Domain of unknown function (DUF2431) (PF10354.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;