Protein coding transcript 6190

• Transcript: Ll_transcript_523950
• CDS coordinates: 968-1660 (+)
• Peptide sequence: MGYDGIVLESWSRWAAYGILHDPNMRNLALQFVKQLGEALHSISSERNSEQQLQLVYVIGPPSSEKLQAHDFGPKDLETLSEAVDGFSLMTYDFSNPHKPGPNAPMKWIQIVLQLLLDTSGNRAKSLAPKILLGINFYGNDFSLSSDSGGGAIIGRGYLTLLEKHKPELQWDKNSGEHFFLYTDDKDIKHAVFYPSLKSISLRLEEALSWGCGISIWEIGQGLDYFFDLL*
• ORF Type: complete

Annotations of Ll_transcript_523950

• Blastp: Chitinase domain-containing protein 1 from Xenopus with 43.72% of identity
• Blastx: Chitinase domain-containing protein 1 from Xenopus with 38.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (447354)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424064.1)
• Pfam: Glycosyl hydrolases family 18 (PF00704.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;