Protein coding transcript 61900

• Transcript: Ll_transcript_420965
• CDS coordinates: 1343-1924 (+)
• Peptide sequence: MQYTGVIGVFNCQGGGWFRETRTNKCASEFSHLVSTNTNIKDIEWNRAKNPISIEGVQLFALYFSQGNKLVLSSPSDSEEISLEPFNFELITVSPVTFLHGKSSSSVVQFAPIGLVNMLNTGGAIQSLAFDEAKNLVEVGVRGKGEMRVFASEKPSTCRIDGEEVHFQYESNMVVIQVPWPSSSKLSNVHYIF*
• ORF Type: complete

Annotations of Ll_transcript_420965

• Blastp: Probable BOI-related E3 ubiquitin-protein ligase 3 from Arabidopsis with 46.63% of identity
• Blastx: Galactinol--sucrose galactosyltransferase from Pisum with 56.1% of identity
• Eggnog: protein binding zinc ion binding(ENOG4111S1X)
• Kegg: Link to kegg annotations (AT3G12920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425195.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;