Protein coding transcript 620

• Transcript: Ll_transcript_468505
• CDS coordinates: 3-428 (+)
• Peptide sequence: QFNRHVGQAVLESYSRIWESLAFTVLSRIDDVLQADYQTQNPAGRKSSARSSVSKSSPREETTLTTDKGSGETPGSMTLLDFMGWDADQGDAELTKKDSFAVSDDFYKETDTKQQKLANLVTKKMSYLENLGVMRSPTSRH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_468505

• Blastp: Rop guanine nucleotide exchange factor 12 from Arabidopsis with 50.69% of identity
• Blastx: Rop guanine nucleotide exchange factor 12 from Arabidopsis with 52.11% of identity
• Eggnog: guanine nucleotide exchange factor(ENOG410YG86)
• Kegg: Link to kegg annotations (AT1G79860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457974.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;