| Transcript | Ll_transcript_468493 |
|---|---|
| CDS coordinates | 3-329 (+) |
| Peptide sequence | KVNIFKDNITIKASVCCDDRPELFSELIQVLKGLRLTTVKADIASAGGRIKSILVLCSKDSEEGSVCLTTLKQSLKSAVNKIASLSTASNYPARSKRQRFFLPSHYLQ* |
| ORF Type | 5prime_partial |
| Blastp | Transcription factor bHLH51 from Arabidopsis with 45.71% of identity |
|---|---|
| Blastx | Transcription factor bHLH51 from Arabidopsis with 45.71% of identity |
| Eggnog | transcription factor(ENOG410ZM5C) |
| Kegg | Link to kegg annotations (AT2G40200) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433720.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer