Protein coding transcript 62109

• Transcript: Ll_transcript_421416
• CDS coordinates: 53-661 (+)
• Peptide sequence: MEDQKQKKPRILCLHGFRTSGEILKKSVLRWPEIVTEKLDLVFLDGKFRAQGKSDVEGIFDPPYYEWFQPKKDFTVYSNFEESVAYIEDYMLKNGPFDGLLGFSQGAMIAAALSGMQAQGVALGKVDKIKFLIIIAGGKFGGKKFGMPKLASKAFSKPIDCPSIHFIGERDSMKPESIALLEAFVDPTVIYHPKGHIIPTLG*
• ORF Type: complete

Annotations of Ll_transcript_421416

• Blastp: Rhodanese-like domain-containing protein 6 from Arabidopsis with 32.02% of identity
• Blastx: Rhodanese-like domain-containing protein 6 from Arabidopsis with 31.58% of identity
• Eggnog: ovarian cancer-associated gene 2 protein(ENOG4111JYH)
• Kegg: Link to kegg annotations (AT1G09280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450018.1)
• Pfam: Serine hydrolase (FSH1) (PF03959.12)
• Rfam: -
• GO: -