Protein coding transcript 62114

• Transcript: Ll_transcript_421397
• CDS coordinates: 1-624 (+)
• Peptide sequence: QRSRARVFNHRIINPFLLVSSHQCSASIFHHPSMAATTTSTCSFHLPSPSLSSHSHFLTNNYSQLSLSPFSPPKFNTYTFSNLASPQNICMPKTFSASFTNPIVSLNREPMVTPYNVLITGSTKGIGYALAREFLKAGDNVLICSRSSERVETSVQSLREEFGEHHVWGTKCDVKNGEDVKNLVSFAQEKLKYIDIWVLMADFFFPP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_421397

• Blastp: Chlorophyll(ide) b reductase NOL, chloroplastic from Arabidopsis with 55.84% of identity
• Blastx: Chlorophyll(ide) b reductase NOL, chloroplastic from Arabidopsis with 76.84% of identity
• Eggnog: serine 3-dehydrogenase activity(COG4221)
• Kegg: Link to kegg annotations (AT5G04900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449362.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;