Protein coding transcript 62115

• Transcript: Ll_transcript_421399
• CDS coordinates: 100-708 (+)
• Peptide sequence: MAATTTSTCSFHLPSPSLSSHSHFLTNNYSQLSLSPFSPPKFNTYTFSNLASPQNICMPKTFSASFTNPIVSLNREPMVTPYNVLITGSTKGIGYALAREFLKAGDNVLICSRSSERVETSVQSLREEFGEHHVWGTKCDVKNGEDVKNLVSFAQEKLKYIDIWINNAGSNAYSYKPLAEASDEDLIEVVTTNTLGLMICCRE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_421399

• Blastp: Chlorophyll(ide) b reductase NOL, chloroplastic from Arabidopsis with 63.54% of identity
• Blastx: Chlorophyll(ide) b reductase NOL, chloroplastic from Arabidopsis with 81.95% of identity
• Eggnog: serine 3-dehydrogenase activity(COG4221)
• Kegg: Link to kegg annotations (AT5G04900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449362.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;