Transcript | Ll_transcript_421406 |
---|---|
CDS coordinates | 53-571 (+) |
Peptide sequence | MEDQKQKKPRILCLHGFRTSGEILKKSVLRWPEIVTEKLDLVFLDGKFRAQGKSDVEGIFDPPYYEWFQPKKDFTVYSNFEESVAYIEDYMLKNGPFDGLLGFSQGAMIAAALSGMQAQGVALGKVDKIKFLIIIAGGKFGGKKFGMPKLASKAFSKPIDCPSIHFIGNIEE* |
ORF Type | complete |
Blastp | Rhodanese-like domain-containing protein 6 from Arabidopsis with 31.58% of identity |
---|---|
Blastx | Chlorophyll(ide) b reductase NOL, chloroplastic from Arabidopsis with 88.24% of identity |
Eggnog | ovarian cancer-associated gene 2 protein(ENOG4111JYH) |
Kegg | Link to kegg annotations (AT1G09280) |
CantataDB | Link to cantataDB annotations (CNT0000254) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449362.1) |
Pfam | Serine hydrolase (FSH1) (PF03959.12) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer