| Transcript | Ll_transcript_421408 |
|---|---|
| CDS coordinates | 53-661 (+) |
| Peptide sequence | MEDQKQKKPRILCLHGFRTSGEILKKSVLRWPEIVTEKLDLVFLDGKFRAQGKSDVEGIFDPPYYEWFQPKKDFTVYSNFEESVAYIEDYMLKNGPFDGLLGFSQGAMIAAALSGMQAQGVALGKVDKIKFLIIIAGGKFGGKKFGMPKLASKAFSKPIDCPSIHFIGERDSMKPESIALLEAFVDPTVIYHPKGHIIPTLG* |
| ORF Type | complete |
| Blastp | Rhodanese-like domain-containing protein 6 from Arabidopsis with 32.02% of identity |
|---|---|
| Blastx | Chlorophyll(ide) b reductase NOL, chloroplastic from Arabidopsis with 88.24% of identity |
| Eggnog | ovarian cancer-associated gene 2 protein(ENOG4111JYH) |
| Kegg | Link to kegg annotations (AT1G09280) |
| CantataDB | Link to cantataDB annotations (CNT0000254) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449362.1) |
| Pfam | Serine hydrolase (FSH1) (PF03959.12) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer