Transcript | Ll_transcript_284824 |
---|---|
CDS coordinates | 390-1376 (+) |
Peptide sequence | MEETQSHYYPSSMPESTLSNDIGGRSNFIGQVNRGLGVPGLKKRGHGTRSWIKIDQDGNSQTLTLDKGTIMRNCALPSRDLRLLDPMFIYPSTILGREKAIVVNLEQIRCIITSDEAILMNSLDGSVGQYRAELCNRLQKEKTDDLPFEFRALELALELTCTSLDAQVKELEMEIYPVLDELALSISTINLERVRRFKGHLLALTQRVQKVRDEIEHLMDDDGDMAEMCLTEKRMRSDSYPLNDYLQTISSGSGRVISRSAPASPEQSTSGLQMLQRAFSSIGNSSKHDSSVRSSDNGERIEPLEMLLEAYFIVIDNTLNTLSSVQEV* |
ORF Type | complete |
Blastp | Magnesium transporter MRS2-5 from Arabidopsis with 62.69% of identity |
---|---|
Blastx | Magnesium transporter MRS2-5 from Arabidopsis with 62.09% of identity |
Eggnog | Magnesium transporter(ENOG410XNNZ) |
Kegg | Link to kegg annotations (AT2G03620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461931.1) |
Pfam | Apolipoprotein A1/A4/E domain (PF01442.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer