Protein coding transcript 62200

• Transcript: Ll_transcript_284836
• CDS coordinates: 1-342 (+)
• Peptide sequence: KGLSHWMLLEAYFIVIDNTLNTLSSLKEYIDDTEDFINIKLGNIQNRLIQFEVLLTAATLVAAVFTVVAGVFGMNFKAPVFNYPFGFHWVLVITGIACASLYIAFLYYFRFKVA
• ORF Type: internal

Annotations of Ll_transcript_284836

• Blastp: Magnesium transporter MRS2-5 from Arabidopsis with 66.98% of identity
• Blastx: Magnesium transporter MRS2-5 from Arabidopsis with 66.98% of identity
• Eggnog: Magnesium transporter(ENOG410XNNZ)
• Kegg: Link to kegg annotations (AT2G03620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461931.1)
• Pfam: CorA-like Mg2+ transporter protein (PF01544.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;