Protein coding transcript 62245

• Transcript: Ll_transcript_284801
• CDS coordinates: 198-815 (+)
• Peptide sequence: MAFSGTQQKCKACDKVVHFVESVSADGITYHKNCFRCSHCNGLLAMSNYSSLDGTLYCKPHFEQVYKETGIKKPQSSGKPPKELTKTASKLSAFFSGTQEKCSTCKKTVYPLEKLTVEGEFYHKSCFRCTHGGCFLTPSTYAALDGFLYCKPHFSQLFKEKGSYSYLSKTASLKKTEQQQAETASDSEPKETTNEEQEAVVTQEQ*
• ORF Type: complete

Annotations of Ll_transcript_284801

• Blastp: LIM domain-containing protein WLIM2a from Arabidopsis with 60.44% of identity
• Blastx: LIM domain-containing protein WLIM2b from Arabidopsis with 60.99% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (AT2G39900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446594.1)
• Pfam: LIM domain (PF00412.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;