Transcript | Ll_transcript_284350 |
---|---|
CDS coordinates | 1716-2078 (+) |
Peptide sequence | MRQIGILCAAALVALQDNVVNLESDHKKARLFADGLNQIKGLRVDGPLETNIVYIDIEEGSHTKAGKICKELEDRGILLMPESLSRLRVVFHHQISASDVQYALSCFKQAVNGVQTENGN* |
ORF Type | complete |
Blastp | Probable low-specificity L-threonine aldolase 1 from Arabidopsis with 80.22% of identity |
---|---|
Blastx | Probable low-specificity L-threonine aldolase 1 from Arabidopsis with 80.22% of identity |
Eggnog | Aldolase(COG2008) |
Kegg | Link to kegg annotations (AT1G08630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439913.1) |
Pfam | Beta-eliminating lyase (PF01212.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer