Protein coding transcript 62324

• Transcript: Ll_transcript_284354
• CDS coordinates: 1561-1923 (+)
• Peptide sequence: MRQIGILCAAALVALQDNVVNLESDHKKARLFADGLNQIKGLRVDGPLETNIVYIDIEEGSHTKAGKICKELEDRGILLMPESLSRLRVVFHHQISASDVQYALSCFKQAVNGVQTENGN*
• ORF Type: complete

Annotations of Ll_transcript_284354

• Blastp: Probable low-specificity L-threonine aldolase 1 from Arabidopsis with 80.22% of identity
• Blastx: Probable low-specificity L-threonine aldolase 1 from Arabidopsis with 80.22% of identity
• Eggnog: Aldolase(COG2008)
• Kegg: Link to kegg annotations (AT1G08630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439913.1)
• Pfam: Beta-eliminating lyase (PF01212.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;