Protein coding transcript 62361

• Transcript: Ll_transcript_286440
• CDS coordinates: 2-406 (+)
• Peptide sequence: SDAVSVLDGTQEGAFQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISETDAMVAPKVPPGDDPYVKEMFLRGRKYYLYVHSYLHYGLLAARAEILKASDDAENPCILAGFDGKYSFSFLYASCYFDDNF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_286440

• Blastp: Apyrase 2 from Arabidopsis with 76.86% of identity
• Blastx: Apyrase 2 from Arabidopsis with 76.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G18280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458467.1)
• Pfam: GDA1/CD39 (nucleoside phosphatase) family (PF01150.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;