Transcript | Ll_transcript_523757 |
---|---|
CDS coordinates | 47-982 (+) |
Peptide sequence | MAFSIFFFLLFITFSYFPFSTALSSEAIFDAADVLSDSGFVSMALTLEVIAESFLSNSPSATVFAPSDSAFRKSGQPSFDLLRFHFVPLPLPPQSLRLLTAGAMIPTMFPGKSLTVTTSSSDHITSINNIKITEAPIYDDGFLIIYGTERFFDPNFQHTGPNQRSNNNPSCVAKNHTANSSDSFDQAIETLKSGGFSAMASFLGTQLSGVSEQSGITVFAPADDMVLNRIGDLSELPWFFRRHVVPCKLLWNDLVNFDDESELPTFLEGFTINITRNGGVLVLNGVQVFYPDIFFNDKVAVHGVSDALTAH* |
ORF Type | complete |
Blastp | Putative fasciclin-like arabinogalactan protein 20 from Arabidopsis with 36.45% of identity |
---|---|
Blastx | Putative fasciclin-like arabinogalactan protein 20 from Arabidopsis with 36.28% of identity |
Eggnog | fasciclin-like arabinogalactan protein(ENOG4111A65) |
Kegg | Link to kegg annotations (AT5G40940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452442.1) |
Pfam | Fasciclin domain (PF02469.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer