Transcript | Ll_transcript_286249 |
---|---|
CDS coordinates | 180-929 (+) |
Peptide sequence | MKNTERFANLALAGLTLAPLVVKVDPNLNVILTACLSVLVGSYRSVKPTPPTETMSREHAMRFPFVGSAVLLSLFLLFKFLSKDLVNTVLTAYFIVLGIVALSATLLPSITRFLPNHWNENPIVWRFPYFSSLDIEFTKSQIVAAIPGTFFCAWYALKKHWLANNLLGLSFCIQGIEMLSLGSFKTGAILLAGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPTFNAARPFSMLGLGDIVIPGRMTLS* |
ORF Type | complete |
Blastp | Signal peptide peptidase from Arabidopsis with 87.3% of identity |
---|---|
Blastx | Signal peptide peptidase from Arabidopsis with 87.3% of identity |
Eggnog | signal peptide peptidase(ENOG410XTES) |
Kegg | Link to kegg annotations (AT2G03120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417006.1) |
Pfam | Signal peptide peptidase (PF04258.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer