Protein coding transcript 62397

• Transcript: Ll_transcript_286249
• CDS coordinates: 180-929 (+)
• Peptide sequence: MKNTERFANLALAGLTLAPLVVKVDPNLNVILTACLSVLVGSYRSVKPTPPTETMSREHAMRFPFVGSAVLLSLFLLFKFLSKDLVNTVLTAYFIVLGIVALSATLLPSITRFLPNHWNENPIVWRFPYFSSLDIEFTKSQIVAAIPGTFFCAWYALKKHWLANNLLGLSFCIQGIEMLSLGSFKTGAILLAGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPTFNAARPFSMLGLGDIVIPGRMTLS*
• ORF Type: complete

Annotations of Ll_transcript_286249

• Blastp: Signal peptide peptidase from Arabidopsis with 87.3% of identity
• Blastx: Signal peptide peptidase from Arabidopsis with 87.3% of identity
• Eggnog: signal peptide peptidase(ENOG410XTES)
• Kegg: Link to kegg annotations (AT2G03120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417006.1)
• Pfam: Signal peptide peptidase (PF04258.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;