Protein coding transcript 6240

• Transcript: Ll_transcript_523765
• CDS coordinates: 732-1292 (+)
• Peptide sequence: MSPNNQHIPWQNAVYEIEDQFLRIASSRSRSLSNQDLELLRKIAGCQEYLTQECFEKLWCWLYPVAFIISRDWINPIWNTTSPKWIEGFITKEEAEASLQGTIGLQEPGTFILRFPTSRSWPHPDAGSLVVTYVGNDYKLHHRLLSMDHVYSSYSSGDKGIDAKPLQDMLLAEPELSRLGRIIRSH*
• ORF Type: complete

Annotations of Ll_transcript_523765

• Blastp: SH2 domain-containing protein B from Arabidopsis with 68.28% of identity
• Blastx: SH2 domain-containing protein B from Arabidopsis with 66.67% of identity
• Eggnog: NA(ENOG41116R2)
• Kegg: Link to kegg annotations (AT1G78540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453520.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;