Protein coding transcript 6242

• Transcript: Ll_transcript_523767
• CDS coordinates: 983-1996 (+)
• Peptide sequence: MKRFRLGQDKISVSVKADPNLVRPDEECNSHVLTSNQVENGFTASLDGRPANFDEAYDCPSDSESIGERNSPPDSMASRRYEISDMTIFKYCLAGLAERSLMLKEIAPSASDKEISELAHHVSLYSGCSHHGNQILIAKRLIKDGINLWKLMSPNNQHIPWQNAVYEIEDQFLRIASSRSRSLSNQDLELLRKIAGCQEYLTQECFEKLWCWLYPVAFIISRDWINPIWNTTSPKWIEGFITKEEAEASLQGTIGLQEPGTFILRFPTSRSWPHPDAGSLVVTYVGNDYKLHHRLLSMDHVYSSYSSGDKGIDAKPLQDMLLAEPELSRLGRIIRSH*
• ORF Type: complete

Annotations of Ll_transcript_523767

• Blastp: SH2 domain-containing protein B from Arabidopsis with 56.97% of identity
• Blastx: SH2 domain-containing protein B from Arabidopsis with 51.29% of identity
• Eggnog: NA(ENOG41116R2)
• Kegg: Link to kegg annotations (AT1G78540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453521.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;