Protein coding transcript 62428

• Transcript: Ll_transcript_285562
• CDS coordinates: 878-1207 (+)
• Peptide sequence: MYLEATTKHLNEYGEVGLRTLALAYRKLDEQEFSAWNSEFQKAKAAVGSDREATLERISEIMEKELILVGATAVEDKLQNGVGLCSFAVFSTSRLLQPISIFFSSGAPMH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_285562

• Blastp: Probable phospholipid-transporting ATPase 5 from Arabidopsis with 76.09% of identity
• Blastx: Probable phospholipid-transporting ATPase 4 from Arabidopsis with 73.91% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G72700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443523.1)
• Pfam: Cation transport ATPase (P-type) (PF13246.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;