Protein coding transcript 6244

• Transcript: Ll_transcript_523795
• CDS coordinates: 811-1386 (+)
• Peptide sequence: MLATSFAILALQQLVSREADPLHSQVVSITFVKGGTALNVIPSYVEFGGTLRSLTTDGLYHLRKRLKEVIEGQAAVQRCNAYVDFKEKYYTPYPAVVNDKDLHLHVERVGQLLLGPDNVHAAEKVMAGEDFAFYQEIIPGAYYSIGIRNEKVGSVHSPHSPFFFLDEDVLPIGAAMHTAVAELYLNEHTVE*
• ORF Type: complete

Annotations of Ll_transcript_523795

• Blastp: IAA-amino acid hydrolase ILR1-like 5 from Oryza sativa with 63.87% of identity
• Blastx: IAA-amino acid hydrolase ILR1-like 5 from Oryza sativa with 62.64% of identity
• Eggnog: amidohydrolase(COG1473)
• Kegg: Link to kegg annotations (4336428)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430974.1)
• Pfam: Peptidase family M20/M25/M40 (PF01546.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;