Protein coding transcript 62477

• Transcript: Ll_transcript_285834
• CDS coordinates: 407-880 (+)
• Peptide sequence: MDENISSNIVPKTKCKFPLTVFFKDARLIFKMDSLAKEILRIAFPSALAVAADPIASLIDTAFIGHLGPVELAAAGVSIALFNQALKISVAPLVSITTSFVAEEDTKEKINTIAAEKQFNESVKAKSIEVTSNDHLPRDIKSENSETPTEAFAANGEK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_285834

• Blastp: Protein DETOXIFICATION 42 from Arabidopsis with 70.45% of identity
• Blastx: Protein DETOXIFICATION 42 from Arabidopsis with 61.32% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT1G51340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425461.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;