Protein coding transcript 62481

• Transcript: Ll_transcript_285846
• CDS coordinates: 180-902 (+)
• Peptide sequence: MALALFSILMRKVDLLPPSIKDLQIFRFLKNGGLLLARVIAVTFCVTLAASLAARLGPIPMAAFQTCLQVWLTSSLLADGLAVAIQAILAGSFAEKDYDKVTAAATRTLQMSFVLGVGLSLVVGVGLYLGAGIFSKSVLVVQLIRLGIPFVAATQPINSLAFVFDGVNYGASDFAYSAYSLVMVSLASVASLFLLYKSKGFIGIWIALTIYMSLRMFAGVWRMGTGTGPWRFLRGPSLSS*
• ORF Type: complete

Annotations of Ll_transcript_285846

• Blastp: Protein DETOXIFICATION 43 from Arabidopsis with 71.06% of identity
• Blastx: Protein DETOXIFICATION 43 from Arabidopsis with 68.61% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT3G08040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425461.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;