| Transcript | Ll_transcript_286352 |
|---|---|
| CDS coordinates | 2103-2429 (+) |
| Peptide sequence | MYTLMSDGYQIFDFVFICSHFQGGHIIFFQSLSLLGYCLFPLDVGALICMLKNNVILKIVVVCVTLAWSSWAAYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAID* |
| ORF Type | complete |
| Blastp | Protein YIPF6 homolog from Dictyostelium with 38.82% of identity |
|---|---|
| Blastx | Protein YIPF6 from Silurana with 40.21% of identity |
| Eggnog | yip1 domain family member(COG5080) |
| Kegg | Link to kegg annotations (DDB_G0282825) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454209.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer